Powershell module is currently in use. With PackageManagement, you can do the following.
Powershell module is currently in use WARNING: The provided service principal secret will be included in the ‘AzureRmContext. 7. You can do this with the Import-Module ExchangeOnlineManagement command. Online. It's possible I'm doing things wrong but wow is this complicated. 6. users and graph. To update the PowerShell module, the old module needs to be uninstalled first before you can install the latest version. After that you can install the PnP SharePoint Online powershell using the executable file or using the Install-Module SharePointPnPPowerShellOnline command. NetCore,AWS. I have removed and the module and installed it again, tried to proceed with the next step: Install-Module -Name VMware. We support username/password auth, device code auth and app-only authentication. 1 version of Sep 16, 2019 · The problem with the particular Software Package that you have mentioned is the fact that it is quite peculiar. If theres only 1 powershell running, close it, then from CMD run powershell -NoProfile -NonInteractive -Command "UnInstall-Module -Name AWSPowerShell -Force" - it could be Sep 22, 2023 · In some cases, you wanted to check the number of commands available in the Microsoft Graph PowerShell Modules. Let us discuss those approaches one by one. The way PnP PowerShell authenticates you to your tenant has changed. Jan 31, 2024 · Install Microsoft. Now it does install as current user and the "run as admin" warning is gone. Now, my goal is to install PackageManagement and PowerShellGet using the following commands: Install-Module Apr 17, 2020 · Steps to reproduce PS C:> Install-Module PowerShellGet -Repository PSGallery -Force -AllowClobber WARNING: The version '1. WARNING: The version ‘2. graph. 1' of module 'PackageManagement' is currently in use. 5\PowerShellGet. Mar 22, 2023 · Install-Module -Name PackageManagement -Force -Scope AllUsers WARNING: The version '1. 10. nupkg files, and support configuration Sep 15, 2018 · Expected Behavior That install-module powershellget -force from an admin prompt works without any errors. 0 Oct 18, 2024 · This can help release any locks on the module that may be preventing uninstallation [1]. Current Behavior PowerShellGet isn't updated and I get this error: 09-15 10:35:46 3> Instal Apr 17, 2020 · Hi Spiceheads Im trying to install the RDS HTML5 Web Client, using the below command from an elevated Powershell PS C:\\Windows\\system32> Install-Module -Name PowerShellGet -Force WARNING: The version ‘1. Install Jul 1, 2022 · PackageManagement (a. E. 1 (before install attempt) PowershellGet 1. Jan 15, 2025 · Open PowerShell and run Uninstall-AksHci. The Module Installing the PnP. Partial list of modules installed: ExchangeOnline Management v3. authentication' is currently in use. Aug 10, 2021 · Everyone manages that part of their environment differently (I use DSC in some to keep things clean). Admins can learn about the installation, maintenance, and design of the Exchange Online PowerShell V3 module that they use to connect to all Exchange cloud-related PowerShell environments. 5 on Windows 10, Windows 10 LTSC, and Windows 11 23H2 using the command you provided, using the default PSRepository named "PSGallery", but were unable to reproduce the issue. 11. Feb 20, 2025 · Thanks for the suggestion. The PowerShellGet and PackageManagement modules originally were released in Windows PowerShell 5. 5. Graph v2. May 14, 2024 · This module requires Az. 183. Tools) are currently installed. The PowerShellGet module is also integrated with the PackageManagement module as a provider. 6’ of module ‘PackageManagement’ is currently in use. Get-Module -ListAvailable -Name MSOnline | ft Name,Version If the version of MSOnline installed in your machine is lower than 1. 0'} Previously I have simply deleted the module in question from the modules dir but there must be a more elegant way to do this The solution posted in the comments about manually deleting the module folder in C:\Program Files\Windows Powershell\Modules also works for forcefully removing a module. The Windows PowerShell script below installs the latest version of the PowerShellGet module, and of the PackageManagement module, on which it depends, side-by-side with the built-in modules. Thank you for posting a question about PowerShell command issues. SharePoint. g. 0, might also be the Version that comes installed with the Microsoft Windows PowerShell Integrated Shell-Scripting Environment (I. PSResourceGet Microsoft. . then try closing your PowerShell console and reopen. PowerShell module is pretty easy, but if you have the older SharePointPnPPowerShellOnline module installed you’ll need to uninstall it first. Or you want to uninstall the older versions of the module to install the May 2, 2023 · Update the module as needed - Update-Module -Name "ModuleName" -Force If updating your module and restarting your PS sessions don't help resolve your issue, you can Uninstall the Az module and re-install it, to ensure you have everything required to lever the PSCloudShellUtility module. PowerShell. x’ of module “PackageManagement” is currently in use. 7’ of module ‘PackageManagement’ is currently in use. It's a bit different but has a few features that are comparable to the ISE. Nov 8, 2021 · I have a problem with Uninstall-Module because I get the following error "Module 'BcContainerHelper' is in currently in use or you don't have the required permissions. Make sure you follow the upgrading instructions to install newer versions of PSReadLine. Graph -Scope CurrentUser -force However, getting warning, WARNING: The The version 2. Aug 19, 2024 · Relatively new to this sort of thing but I'm having a problem with Powershell that after hours of troubleshooting I cannot resolve. 0-rc2 - adds Compress-PSResource to create . Accounts version 2. Here's how you can update it. Install-Module -Name Microsoft. Follow our step-by-step guide and remove unnecessary modules. Pester is a PowerShell Module that is used for testing PowerShell Modules. Oct 16, 2024 · Warning Messages When Installing MSP360 PowerShell Module For the First Time In some cases when installing the MSP360 PowerShell you may get the warning “The version ‘x. When installing EOL v3. json’ file found in the user profile ( C:\Users\zzadmin. a. Feb 20, 2025 · PowerShell 7. The `Get-Module` cmdlet in PowerShell is used to retrieve information about the modules that are currently imported within your PowerShell session or that are available on your system. PowerShellGet module is also integrated with the PackageManagement module as a provider, users can also use the PowerShell PackageManagement cmdlets for discovering, installing and updating the PowerShell artifacts like Modules and Scripts. I rebooted everything accept the Internet and ChatGPT. Jan 30, 2025 · So here is what I have discovered. -S. 1, I need to use the newer version of PowerShellGet so I can use the -AllowPrerelease option of Install-Module. 0 in your case). This isn't an issue with the module, it's an issue with Windows PowerShell ISE. 1 of PackageManagement preinstalled. 0' of module 'PackageManagement' is currently in use. After some trial and error, I’m now trying to completely remove SharePointPnpPowerShellOnline (which I installed prior), but I just can’t seem to uninstall it! Dec 13, 2016 · Remove-Module -FullyQualifiedName @{ModuleName = 'SharePointPnPPowerShellOnline'; ModuleVersion = '2. 5" -Prefix now_psg Jan 28, 2025 · Hi Julien Garrigue, Welcome to Microsoft Community. 0 installation failing (Image runner creation) actions/runner-images#6896 Feb 9, 2023 · The same is true for the PackageManagement module (try running Update-Module -Name PackageManagement and you'll get a similar error). Keep your system current and secure. Please see https://aka. 1 comes with version 1. 0 cannot be imported on Windows PowerShell on Jan 11, 2023 HUMBERP mentioned this on Jan 11, 2023 [Windows2022] Az module version to 9. Instead we have excerpts from seven books from Manning Press. 1 (PowerShell Core) Following MS instructions, I want to install the Az module in PowerShell 7. Supported versions: Current releases Microsoft. Or you want to uninstall the older versions of the module to install the latest version. PackageManagement\\Install-Package : The module ‘PowerShellGet’ cannot Aug 17, 2025 · In this blog post, I will show you the steps to remove old PowerShellGet and PackageManagement Modules. Please ensure that this directory has appropriate Feb 20, 2022 · Hi All i want to install exchange online PowerShell module, SharePoint PowerShell module and teams module. This error could indicate that multiple incompatible versions of the Azure PowerShell cmdlets are installed on your system. 1' of module 'PackageManagement' is currently in use" and you'll find several posts (mostly in StackOverflow) that have different ways of addressing this. If you encounter the error, WARNING: The version '1. You can use the Get-Command cmdlet, push them into a pipeline then use the measure parameter. Show installed Versions and what’s available When you import a module from a different session into the current session, you can use the cmdlets from the module in the current session, just as you would use cmdlets from a local module. Please check that no policies at the subscription or resource group level that might be blocking the deployment. Jan 18, 2023 · Description My Windows 11 laptop has two versions of PowerShell installed: 5. Update PowerShellget module The script uses functions from a newer PowerShellGet module (Version 2. Dec 28, 2020 · Time to install some modules. By following these steps, you should be able to successfully uninstall the 'PnP. 0 which itself was part of the Windows Management Framework (WMF) 5. VERBOSE: Validating the 'PowerShellGet' module contents under 'C:\Users\joakim. The cleanest way to be sure it isn't locked is to exit the PowerShell session. Jul 22, 2020 · hi i installed powershell via snap , but when i try to install “Install-Module -Name PowerShellGet” its says: WARNING: The version ‘1. However, it can be installed side-by-side with the existing PowerShellGet module. Commands in PowerShell are implemented as scripts, functions, or cmdlets. Jun 26, 2018 · 3 As mentioned in the comments, you need to use the Uninstall-Module SharePointPnPPowerShell2016 to remove the PnP PowerShell 2016. This was back in early 2016. Install-Module Microsoft. PSResourceGet 1. is the latest currently anyway (for both graph. Jan 17, 2024 · Module not imported: Even if the module is installed, it needs to be imported into your PowerShell session before you can use it. Jul 11, 2021 · I'm trying to uninstall a module from powershell but I can't. westin\AppData\Local\Temp\1327786590\PowerShellGet. 3. 0' of module 'PnP. This | error could indicate that multiple incompatible versions of the Azure PowerShell cmdlets are | installed on your system. I am using the new PSResourceGet here instead of the PowerShellGet commands. 1' of module 'PackageManagement' is currently in use Sep 26, 2020 · Here is my powershell command sequence. I have configured Tls2, set PSGallery as trusted, and adjusted the execution policy to RemoteSigned (Scope: LocalMachine). In addition, each blog will have a special code for […] PowerShell is a cross-platform (Windows, Linux, and macOS) automation tool and configuration framework optimized for dealing with structured data (e. Use Case This script is useful for: Script PowerShell Explanation Outro This script provides a quick and easy way to refresh your […] Jul 6, 2023 · Well, I "fixed" the rights to the network share to test it out, now it installs as current user directly on the network share where user files are redirected. PS /Users/kyrieirving> Install-Module -Name ExchangeOnlineManagement -Force WARNING: The version '1. Powershell says it can't find that module by name but when I list all installed modules, it is right there. Accounts' is currently in use. I am running on a windows server and on PowerShell 5. This gives PowerShell the ability to understand and use commands related to Exchange Online. 5 with PackageManagement 1. 2. An earlier version of Az. 963 (Windows PowerShell) 7. The Jan 18, 2024 · Az. May 16, 2023 · PS > update-module PnP. 0 PS C:\Windows\System32> Install-Module -Name ExchangeOnlineManagement -allowprerelease -Force WARNING: The version '1. May 21, 2024 · Check TaskManager -> (More Details) -> Details tab, do you have multiple open powershell sessions? (ie powershell. In this video I'll go through your quest Mar 6, 2024 · Import-Module : The required module 'PackageManagement' is not loaded. 1 - a standalone module that doesn't depend on the PowerShellGet or PackageManagement modules PowerShellGet 2. PS C:\WINDOWS\system32> install-module -name PowerShellGet -Force WARNING: The version '1. PowerShell includes a command-line shell, object-oriented scripting language, and a set of tools for executing scripts/cmdlets and managing modules. Common -ListAvailable' for details. Any number of things can cause PowerShell to auto-load a module so even in a different module or script it won't guarantee that it will clean up every version. It is like Nuget is constipated. Accounts is imported in the current PowerShell session. We would like to show you a description here but the site won’t allow us. 0 PS C:\\Windows\\System32> Install-Module -Name PowerShellGet -Force -AllowClobber WARNING: The version '1. (source: GitHub) Sep 26, 2020 · WARNING: The version ‘1. Retry the operation after closing the applications” This means that another version of the PackageManagement module is already installed and is currently in Oct 15, 2023 · Run the following command: Get-Module -Name MicrosoftTeams This will list all of the Microsoft Teams PowerShell modules that are installed on your computer. psd1' When I check the C:\Program Files\WindowsPowerShell\Modules\PowerShellGet\2. 1611. Microsoft Scripting Guy, Ed Wilson, is here. This can be helpful when troubleshooting issues with the modules or ensuring you have the latest versions installed. k. We now use OAuth behind the scenes to authenticate you. Here's a code snippet demonstrating how to use `Get-Module`: Get-Module -ListAvailable This command lists all the available modules on your system. ms/azps-version-error for troubleshooting | information. StackHCI PS module Az. 19. 2 v3. Dec 11, 2024 · Introduction This PowerShell script demonstrates how to completely remove and reinstall the Microsoft Graph modules. I also tried the original install adding the -AllowClobber parameter. When I try to install ExchangeOnlineManagement I get the following … Sep 17, 2025 · Want to install the Exchange Online PowerShell Module for Microsoft 365? Learn how to do that in simple steps with this comprehensive guide! If you encounter the error, WARNING: The version '1. Below is a screenshot of the Module that it is installed: This topic displays help topics for the Package Management Cmdlets. Installer - Update-AzModules will not replace old Az module versions if run in VSCode integrated terminal #23999 Dec 2, 2024 · There is a newer prerelease version of this module available. PowerShell -force PS > But the surprise? This doesn't update the module if it has been installed in any other than way than PowerShellGet (which is what Update-Module uses). Tools. I cannot get past his in-use situation. I am currently weaning myself off of the ISE and am using Visual Studio Code. I tried rebooting and tried to update the Powershell get and package management as you recommended. According to the PowerShell 6 documentation, "ListAvailable does not return information about modules that are not found in the PSModulePath environment variable, even if those modules are loaded in the current session". ) and that can May 18, 2023 · In PowerShell 5. You can use the prefix (-Prefix parameter of the Import-Module command) when manually importing the new PowerShellGet module, as follows: Import-Module -Name PowerShellGet -Version "2. 1 (before install attempt) No other sessions running. 0 (scope CurrentUser) Microsoft. WARNING: The version '2. With PackageManagement, you can do the following. Aug 31, 2021 · I’m currently fumbling around, trying to pull a directory/file index from one of my Company’s SharePoint sites. 23 hours ago · PowerShell 7 lacks a clear visual indicator of which version is running, and it does not automatically detect when a script or module requires legacy support from Windows PowerShell 5. How can I efficiently remove a specific PowerShell module from the command-line without affecting other modules on my system? To efficiently remove a specific PowerShell module from the command-line, without affecting other modules on your system, you can use the Uninstall-Module cmdlet. 22621. See the version list below for details. S. Jan 18, 2023 · This one returns a Warning: WARNING: The version '1. Recently, I was installing Exchange Online PowerShell -verbose WARNING: The version '1. This documentation cover version 1. If problems persist, consider checking online forums or communities for additional troubleshooting tips. PowerShell" Setup authentication. powershell: PowerShell 5. Important Windows PowerShell 5. Mar 13, 2021 · VERBOSE: Module 'PackageManagement' is in currently in use or you don't have the required permissions. 0 via Install-Module with the scope CurrentUser and Force May 22, 2020 · Learn how to efficiently update PowerShellGet and Package Management with our step-by-step guide. 81, please follow the appropriate steps mentioned below to update your MSOnline May 19, 2023 · Load the Exchange Online PowerShell Module: If you've installed the Exchange Online PowerShell Module, we need to load it into your session. Feb 14, 2025 · Search for "WARNING: The version '1. 0 (scope CurrentUser) PackageManagement 1. Accounts’ is currently in use. Any other PS windows open? Try closing any and even rebooting to make sure Apr 5, 2013 · Summary: Bruce Payette talks about how to remove a module that has been loaded into your Windows PowerShell environment. This week we will not have our usual PowerTip. View module names, versions, and locations, etc. A module is a self-contained, reusable unit that can include cmdlets, providers, functions, variables, and other Mar 22, 2025 · Hi All, Yesterday Microsoft has released the ExchangeOnlineManagement 3. psd1 file I can see that the RequiredModules section lists Install-Module -Name "PnP. So I run Uninstall-Module -Name "PnP. It is a manager or multiplexor of existing package managers (also called package providers) that unifies Windows package management with a single Windows PowerShell interface. 1 Preview releases Microsoft. I've installed PowerShellGet 2. 9. Are the below syntaxes correct. PS C:\WINDOWS In some cases, you no longer work with Microsoft Graph PowerShell and want to remove them from your computer completely. Accounts is imported | in the current PowerShell session. ), REST APIs, and object models. 1 - How to uninstall module which is currently useThanks for taking the time to learn more. Please ensure that this directory has appropriate protections. PowerShell won’t install all of its cmdlets while there are collisions with the old Nov 11, 2021 · How to list installed PowerShell Modules, find all installed and loaded modules in current session. 7' of module 'PackageManagement' is currently in use. Jan 11, 2023 · isra-fel changed the title Az. While we would like to try to provide you with precise guidance, members Jun 13, 2024 · In some cases, you no longer work with Microsoft Graph PowerShell and want to remove them from your computer completely. Feb 21, 2021 · PS C:\WINDOWS\system32> Install-Module -Name PowerShellGet -Force -Scope CurrentUser WARNING: The version '1. This places unnecessary burden on users to manually identify compatibility issues, especially when scripts fail Mar 2, 2025 · Get-Module is a PowerShell cmdlet that displays information about modules that are currently loaded into your PowerShell session. PS C:\Application01>Install-Module -Name Az -AllowClobber -Scope AllUsers PS C:\Application01>Connect-AzAccount ### this prompts me f Jun 26, 2025 · Learn how to list installed PowerShell modules with simple commands such as Get-Module -ListAvailable. The cmdlet reference documentation on this site documents the latest version of the module. To keep things nice and tidy, it also removes any previous versions. " After completing the steps, start a new PowerShell session and retry the module installation. Sep 17, 2025 · Learn how to uninstall PowerShell modules using the Uninstall-Module cmdlet. json' file found in the user profile ( C:\Users\zzadmin\. We tried to test PowerShell 7. I hope this helps! Mar 19, 2018 · Wow, check this out. With this module, you no longer need to use PowerShellGet and PackageManagement. exe have exited, and run the below C:\WINDOWS\system32>powershell -command "Install-Module -Name PowerShellGet Feb 15, 2019 · For example you use PowerShellGet to install the Azure PowerShell module, or other modules. 4’ of module ‘Az. 5 using the methods found here and here, but I still can't use -AllowPrerelease. x. PowerShell is a cross-platform (Windows, Linux, and macOS) automation tool and configuration framework optimized for dealing with structured data (e. 0 RTM. 0 breaks current Az. Please run 'Get-Module -Name AWSPowerShell,AWSPowerShell. Here’s an example of how to use it Jul 26, 2021 · About the Exchange Online PowerShell V3 module Admins can learn about the installation, maintenance, and design of the Exchange Online PowerShell V3 module that they use to connect to all Exchange-related PowerShell environments in Microsoft 365. Feb 20, 2025 · WARNING: The version '1. Retry the operation May 18, 2023 · Ukiman1014 I think you can refer to the about_Command_Precedence description, which describes how PowerShell determines the command to run. Mar 21, 2023 · WARNING: The version '1. 2 PowerShell Module. I don't see this as being worth the effort to maintain. Accounts 2. Or, I presume, it is installed in a different folder because you have multiple PowerShell versions and some just install modules in different folders. Feb 20, 2025 · I am working on an email configuration for our ERP program and am following the instructions in the provided guide since I am still learning Powershell. 1 of the PackageManagement module. I've tried to remove the module and uninstall the module and I get the same error, the server has also had a reboot and there are no other users on it. Run the following command to uninstall the module: Uninstall-Module -Name MicrosoftTeams -Version 5. PowerShell' module. I have identified some quick approaches. Nov 1, 2022 · 2 When I run a powershell script, I get the following warning: WARNING: Multiple variants of AWS Tools for PowerShell (AWSPowerShell, AWSPowerShell. 1. WARNING: The provided service principal secret will be included in the 'AzureRmContext. This version of PowerShellGet has a limited features and doesn't Feb 26, 2015 · If you are importing libraries using Import-Module and a custom dll file, don't use the -ListAvailable option to determine if the module is installed because it won't be listed. Running a module install with allusers scope just does nothing at all. nupkg files, the ability to publish . OneGet) is a new way to discover and install software packages from around the web. Still no luck. Another process may be using the module (like VS Code, for example), or the module may have been installed as "Per user". To uninstall the old v2 module, execute the following command: Jan 20, 2025 · Learn how to find, install, verify and remove PowerShell modules efficiently. This cmdlet allows you to uninstall a module by specifying its name. Master module management to enhance your PowerShell automation capabilities. The language includes keywords, which provide the structure and logic of processing, and other resources, such as variables, providers, aliases. PowerShell Gallery ExchangeOnlineManagement 3. Find the version of the module that is currently in use (5. 4' of module 'Az. 4. exe listed - could also be another user, a scheduled task or something using the module). Feb 25, 2020 · Therefore, Install-Module cannot remove those assemblies and thus believe the module is still in use. Retry the operation after closing the applications. 2: Added a new parameter -DisableWAM to the Connect-ExchangeOnline cmdlet, which disables the Web Account Manager (WAM). NetCore or AWS. Azure ). Nov 13, 2024 · Hi All, I’m trying to install Exchange Online module oi MacOS Sequoia but getting this. close the PowerShell session and open a new one before running Install-AksHci again. PowerShell 7. 6' of module 'PackageManagement' is currently in use. 1’ of module ‘PowerShellGet’ is currently in use. PS C:\WINDOWS\system32> exit # OK, check taskmgr that all powershell. 0. 8. Alternatively, you can install the module manually using the instructions below. 5). Download link - PnP PowerShell Dec 12, 2023 · The script checks if the Exchange Online PowerShell module is installed and displays the version installed or advises that it is not installed. Keeping this short as it is a straightforward question. Sep 29, 2025 · PowerShell is both a command shell and a scripting language. PowerShell" as directed, but then I get this error: WARNING: The version '2. Load the module or remove the module from 'RequiredModules' in the file 'C:\Program Files\WindowsPowerShell\Modules\PowerShellGet\2. Oct 1, 2024 · As a PowerShell admin, you must know the quickest way to uninstall the Azure AD module in PowerShell. Check the version of MSOnline module installed in the machine that hosts M365 Manager Plus by running the following command in Windows PowerShell. Its Version that you have mentioned in your example, 3. If you were using Connect-PnPOnline with the -Credentials you will have to register first an Azure AD application on your tenant Jul 11, 2022 · What does the script do? The script updates all installed PowerShell modules to the latest version and, if specified, updates them to the latest prerelease version. When updated, it shows the current and new versions. PowerCLI -SkipPublisherCheck -Force -AllowClobber But getting Aug 13, 2018 · The easiest way to upgrade your PowershellGet module is to run the following command: Find-Module powershellget | Install-Module After that, check your installed versions: Get-Module powershellget -ListAvailable Get-Module packagemanagement -ListAvailable If you have multiple versions, the best thing todo is to remove the older versions. PowerShell' is currently in use. - Manage a list of software repositories in which packages Jun 2, 2025 · Struggling with the 'PackageManagement' error? Here’s how to tackle installation issues in PowerShell. Sep 11, 2024 · An earlier version of Az. May 6, 2023 · Current versions of Windows come with a version of PowerShellGet pre-installed. PowerShell Connect-SPOService (get-credential -UserName… Jul 29, 2022 · I'm using below command for installing powerShell in VS code tool in a Windows 10 enterprise AVD. I'm unable to execute commands like ipconfig, whoami, ping, etc. The cmdlet names in both modules are the same, So PnP. 0 of module 'Microsoft. JSON, CSV, XML, etc. 5' of module 'PowerShellGet' is currently in use. 5' path. If you need to keep the session around to do "stuff" afterwards, trying starting a new PowerShell session (nested session) just before you make use of the module, then exit it at the end. Modules are packages that contain cmdlets, functions, variables, and other resources, and they extend the functionality of PowerShell. The 1. exe, powershell_ise. 3, so I use this command: In Feb 9, 2023 · Microsoft has introduced a new Exchange Online PowerShell module (v3) and the previous modules will be deprecated in the (near) future. authentication) personally I'd be checking WHERE you graph modules are installed and what version of powershell you are using (I know you said ISE, but check anyway) Stolen from a previous comment of mine ya as i mentioned earlier, that's where your Aug 10, 2024 · I am currently attempting to install PackageManagement in Powershell version 7. PSResourceGet is the new package management solution for PowerShell. Please open a new session before importing this module. edqhqqxxueeacymxnikhlsdzgitrivtddfcmkilriqpnhidlgtigefjsdgrymlnslmivzuzettr